Pairwise AlignmentGlobal & local alignmentAnders Gorm

Pairwise AlignmentGlobal & local alignment Anders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis

Sequences are related Darwin: all organisms are related through descent with modification => Sequences are related through descent with modification => Similar molecules have similar functions in different organisms Phylogenetic tree based on ribosomal RNA: three domains of life

Why compare sequences? Determination of evolutionary relationships Prediction of protein function and structure (database searches). Protein 1: binds oxygen Sequence similarity Protein 2: binds oxygen ?

Dotplots: visual sequence comparison Place two sequences along axes of plot Place dot at grid points where two sequences have identical residues Diagonals correspond to conserved regions

Pairwise alignments

43.2% identity; Global alignment score: 374 10 20 30 40 50 alpha V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSA : :.: .:. : : :::: .. : :.::: :... .: :. .: : ::: :. beta VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNP 10 20 30 40 50 60 70 80 90 100 110 alpha QVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHL .::.::::: :.....::.:.. .....::.:: ::.::: ::.::.. :. .:: :. beta KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF 60 70 80 90 100 110 120 130 140 alpha PAEFTPAVHASLDKFLASVSTVLTSKYR :::: :.:. .: .:.:...:. ::. beta GKEFTPPVQAAYQKVVAGVANALAHKYH 120 130 140

Pairwise alignment Percent identity is not a good measure of alignment quality 100.000% identity in 3 aa overlap SPA ::: SPA

Pairwise alignments: alignment score 43.2% identity; Global alignment score: 374 10 20 30 40 50 alpha V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSA : :.: .:. : : :::: .. : :.::: :... .: :. .: : ::: :. beta VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNP 10 20 30 40 50 60 70 80 90 100 110 alpha QVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHL .::.::::: :.....::.:.. .....::.:: ::.::: ::.::.. :. .:: :. beta KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF 60 70 80 90 100 110 120 130 140 alpha PAEFTPAVHASLDKFLASVSTVLTSKYR :::: :.:. .: .:.:...:. ::. beta GKEFTPPVQAAYQKVVAGVANALAHKYH 120 130 140

Alignment scores: match vs. mismatch Simple scoring scheme (too simple in fact…): Matching amino acids: 5 Mismatch: 0 Scoring example: K A W S A D V : : : : : K D W S A E V 5+0+5+5+5+0+5 = 25

Pairwise alignments: conservative substitutions 43.2% identity; Global alignment score: 374 10 20 30 40 50 alpha V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSA : :.: .:. : : :::: .. : :.::: :... .: :. .: : ::: :. beta VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNP 10 20 30 40 50 60 70 80 90 100 110 alpha QVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHL .::.::::: :.....::.:.. .....::.:: ::.::: ::.::.. :. .:: :. beta KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF 60 70 80 90 100 110 120 130 140 alpha PAEFTPAVHASLDKFLASVSTVLTSKYR :::: :.:. .: .:.:...:. ::. beta GKEFTPPVQAAYQKVVAGVANALAHKYH 120 130 140

Amino acid properties Serine (S) and Threonine (T) have similar physicochemical properties Aspartic acid (D) and Glutamic acid (E) have similar properties Substitution of S/T or E/D occurs relatively often during evolution => Substitution of S/T or E/D should result in scores that are only moderately lower than identities =>

Protein substitution matrices

A 5 R -2 7 N -1 -1 7 D -2 -2 2 8 C -1 -4 -2 -4 13 Q -1 1 0 0 -3 7 E -1 0 0 2 -3 2 6 G 0 -3 0 -1 -3 -2 -3 8 H -2 0 1 -1 -3 1 0 -2 10 I -1 -4 -3 -4 -2 -3 -4 -4 -4 5 L -2 -3 -4 -4 -2 -2 -3 -4 -3 2 5 K -1 3 0 -1 -3 2 1 -2 0 -3 -3 6 M -1 -2 -2 -4 -2 0 -2 -3 -1 2 3 -2 7 F -3 -3 -4 -5 -2 -4 -3 -4 -1 0 1 -4 0 8 P -1 -3 -2 -1 -4 -1 -1 -2 -2 -3 -4 -1 -3 -4 10 S 1 -1 1 0 -1 0 -1 0 -1 -3 -3 0 -2 -3 -1 5 T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 2 5 W -3 -3 -4 -5 -5 -1 -3 -3 -3 -3 -2 -3 -1 1 -4 -4 -3 15 Y -2 -1 -2 -3 -3 -1 -2 -3 2 -1 -1 -2 0 4 -3 -2 -2 2 8 V 0 -3 -3 -4 -1 -3 -3 -4 -4 4 1 -3 1 -1 -3 -2 0 -3 -1 5 A R N D C Q E G H I L K M F P S T W Y V BLOSUM50 matrix: Positive scores on diagonal (identities) Similar residues get higher (positive) scores Dissimilar residues get smaller (negative) scores

Pairwise alignments: insertions/deletions 43.2% identity; Global alignment score: 374 10 20 30 40 50 alpha V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSA : :.: .:. : : :::: .. : :.::: :... .: :. .: : ::: :. beta VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNP 10 20 30 40 50 60 70 80 90 100 110 alpha QVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHL .::.::::: :.....::.:.. .....::.:: ::.::: ::.::.. :. .:: :. beta KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF 60 70 80 90 100 110 120 130 140 alpha PAEFTPAVHASLDKFLASVSTVLTSKYR :::: :.:. .: .:.:...:. ::. beta GKEFTPPVQAAYQKVVAGVANALAHKYH 120 130 140

Alignment scores: insertions/deletions K L A A S V I L S D A L K L A A - - - - S D A L -10 + 3 x (-1)=-13 Affine gap penalties: Multiple insertions/deletions may be one evolutionary event => Separate penalties for gap opening and gap elongation

Protein substitution matrices

A 5 R -2 7 N -1 -1 7 D -2 -2 2 8 C -1 -4 -2 -4 13 Q -1 1 0 0 -3 7 E -1 0 0 2 -3 2 6 G 0 -3 0 -1 -3 -2 -3 8 H -2 0 1 -1 -3 1 0 -2 10 I -1 -4 -3 -4 -2 -3 -4 -4 -4 5 L -2 -3 -4 -4 -2 -2 -3 -4 -3 2 5 K -1 3 0 -1 -3 2 1 -2 0 -3 -3 6 M -1 -2 -2 -4 -2 0 -2 -3 -1 2 3 -2 7 F -3 -3 -4 -5 -2 -4 -3 -4 -1 0 1 -4 0 8 P -1 -3 -2 -1 -4 -1 -1 -2 -2 -3 -4 -1 -3 -4 10 S 1 -1 1 0 -1 0 -1 0 -1 -3 -3 0 -2 -3 -1 5 T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 2 5 W -3 -3 -4 -5 -5 -1 -3 -3 -3 -3 -2 -3 -1 1 -4 -4 -3 15 Y -2 -1 -2 -3 -3 -1 -2 -3 2 -1 -1 -2 0 4 -3 -2 -2 2 8 V 0 -3 -3 -4 -1 -3 -3 -4 -4 4 1 -3 1 -1 -3 -2 0 -3 -1 5 A R N D C Q E G H I L K M F P S T W Y V BLOSUM50 matrix: Positive scores on diagonal (identities) Similar residues get higher (positive) scores Dissimilar residues get smaller (negative) scores

Pairwise alignment Optimal alignment: alignment having the highest possible score given a substitution matrix and a set of gap penalties

Pairwise alignment: the problem The number of possible pairwise alignments increases explosively with the length of the sequences: Two protein sequences of length 100 amino acids can be aligned in approximately 1060 different ways Time needed to test all possibilities is same order of magnitude as the entire lifetime of the universe.

Pairwise alignment: the solution ”Dynamic programming” (the Needleman-Wunsch algorithm)

Alignment depicted as path in matrix T C G C A T C C A T C G C A T C C A TCGCA TC-CA TCGCA T-CCA

Alignment depicted as path in matrix T C G C A T C C A x Meaning of point in matrix: all residues up to this point have been aligned (but there are many different possible paths). Position labeled “x”: TC aligned with TC --TC -TC TC TC-- T-C TC

Dynamic programming: computation of scores T C G C A T C C A x Any given point in matrix can only be reached from three possible previous positions (you cannot “align backwards”). => Best scoring alignment ending in any given point in the matrix can be found by choosing the highest scoring of the three possibilities.

Login using your SlideFinder account

Or use your third party provider to login

Pairwise AlignmentGlobal & local alignmentAnders Gorm Pedersen Molecular Evolution Group Center for Biological Sequence Analysis